Welcome
Sign in to track orders and access batch certificates.
Welcome
Sign in to track orders and access batch certificates.
Sermorelin is a peptide used or investigated in pituitary growth-hormone release research.
Price range: $60.00 through $100.00
Research use only. Not for human consumption.
Supplied solely for laboratory and scientific research.
Sermorelin is a peptide used or investigated in pituitary growth-hormone release research. Its principal scientific rationale involves ghrh receptor agonist. Product identity, purity, counterion, water content, sterility and stability must be established using qualified specifications and lot-specific analytical testing. Regulatory and clinical status should be independently reviewed before any commercial or human-use decision.
| Mechanism of Action | Primary Research Applications | CAS Number | Molecular Formula | Molecular Weight (g/mol) | IUPAC / Sequence Definition | Material Class | Form / Appearance |
| GHRH receptor agonist | Pituitary growth-hormone release research | 86168-78-7 | C149H246N44O42S | 3357.88 | YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2 | Peptide | White to off-white lyophilized cake/powder |
| Weight | 1 lbs |
|---|---|
| Dimensions | 12 × 6 × 4 in |
| Strength | 5 Milligram, 10 Milligram |
These products are intended exclusively for laboratory research and in vitro scientific studies. They are *not* approved for human or animal consumption, medical treatment, diagnostic purposes, or veterinary applications.
We are an independent supplier and are not affiliated with, endorsed by, or associated with any pharmaceutical company or its products.
By purchasing these materials, you acknowledge and agree that they will be handled only by appropriately licensed, qualified, and trained professionals in a controlled research environment. Under no circumstances should these compounds be administered to humans or animals.
These products are not classified as drugs, food products, dietary supplements, cosmetics, or medical devices and must not be marketed, labeled, or used as such.
You May Also Research
FDA Disclaimer: The statements made within this website have not been evaluated by the US Food and Drug Administration. The statements and the products of this company are not intended to diagnose, treat, cure or prevent any disease.
Avid Peptides is a chemical supplier. Avid Peptides is not a compounding pharmacy or chemical compounding facility as defined under 503A of the Federal Food, Drug, and Cosmetic act. Avid Peptides is not an outsourcing facility as defined under 503B of the Federal Food, Drug, and Cosmetic act.
All products are sold for research, laboratory, or analytical purposes only, and are not for human consumption.